1. This site uses cookies. By continuing to use this site, you are agreeing to our use of cookies. Learn More.

I'm creating a new web 2.0 website for your benefit! Help me choose a name.

Discussion in 'Making Money' started by Rushdie, Apr 9, 2009.

  1. Rushdie

    Rushdie BANNED BANNED

    Joined:
    Feb 2, 2009
    Messages:
    1,378
    Likes Received:
    1,720
    Ok. So over the past few months on BHW I've seen that there are many shitty CPA programs and networks. With my pal, we've came up a great idea. We will create a web 2.0 revolutionary ranking type of site for affiliate programs. I don't want to tell you al the details now, but it will be awesome.

    It will allow everyone who will submit a program to earn recursively forever. It will also be a good source of info. We won't do any bullshit on there. My coder is just finishing the mods for a cms.

    I'm looking through my domains, thinking of some new name maybe. So far i got 2 domains, what do you think? Maybe point your own advice:

    1. AffiliateXY.com (shortname=AXY), easy name, XY as in the cartesian product i.e. a ranking.

    or

    2. Fraux.com - just a short, catchy name, that doesn't have anything to do with CPA and marketing.

    or

    3. Your idea?

    Name your call and THANKS for help. You, blackhatters are the best.:)
     
  2. simplybebop

    simplybebop Regular Member

    Joined:
    Oct 24, 2008
    Messages:
    371
    Likes Received:
    177
    Location:
    Greesnboro, NC
    flimflamflaboozle.com
     
    • Thanks Thanks x 2
  3. Rushdie

    Rushdie BANNED BANNED

    Joined:
    Feb 2, 2009
    Messages:
    1,378
    Likes Received:
    1,720
    dear Sir, I'm mostly thankful, as that was what i was looking for
     
  4. simplybebop

    simplybebop Regular Member

    Joined:
    Oct 24, 2008
    Messages:
    371
    Likes Received:
    177
    Location:
    Greesnboro, NC
    You like it?
     
  5. Rushdie

    Rushdie BANNED BANNED

    Joined:
    Feb 2, 2009
    Messages:
    1,378
    Likes Received:
    1,720
    no, but you gave me inspiration, i think ill register flaflamflimflamflaboozleonastick.com
     
    • Thanks Thanks x 1
  6. raizoir

    raizoir Junior Member

    Joined:
    Nov 17, 2008
    Messages:
    112
    Likes Received:
    9
    That doesnt sound really cool, in my opinion.. :/
     
  7. Rushdie

    Rushdie BANNED BANNED

    Joined:
    Feb 2, 2009
    Messages:
    1,378
    Likes Received:
    1,720
    ok i was just kidding obviously mate.

    to the point do you like 1 of the 2 names in the first post or do you have some ideas:) ?
     
  8. stevesdata

    stevesdata Regular Member

    Joined:
    Nov 3, 2008
    Messages:
    357
    Likes Received:
    140
    Location:
    Next to Chuck Norris
    flimyflamschnickycpacashycashschizzzle.org

    or

    cashizzzle.com

    :)
     
    • Thanks Thanks x 1
  9. Rushdie

    Rushdie BANNED BANNED

    Joined:
    Feb 2, 2009
    Messages:
    1,378
    Likes Received:
    1,720
    thanks i didnt know the nameboy.

    Burne> good point

    What do you guys think about the AffiliateXY.com one?
     
  10. ShadeDream

    ShadeDream Elite Member

    Joined:
    Nov 27, 2008
    Messages:
    2,209
    Likes Received:
    5,230
    Location:
    He who laughs last, laughs longest.
    :lmao: :lmao: :lmao: :lmao: I actually liked it, but this made me laugh. ^^
     
    • Thanks Thanks x 2
  11. darkman

    darkman Regular Member

    Joined:
    Jan 17, 2009
    Messages:
    454
    Likes Received:
    264
    affiliateworld.com
    worldaffiliate.com
    cpa-on-fire.com
     
    • Thanks Thanks x 1
  12. grahamhead

    grahamhead Registered Member

    Joined:
    Jan 13, 2009
    Messages:
    72
    Likes Received:
    17
    Home Page:
    zimples.com
     
    • Thanks Thanks x 1
  13. jake3340

    jake3340 Jr. VIP Jr. VIP Premium Member

    Joined:
    Nov 20, 2008
    Messages:
    1,368
    Likes Received:
    414
    Location:
    Pluto
    hot-cpa.com
     
    • Thanks Thanks x 1
  14. infinity0

    infinity0 Junior Member

    Joined:
    Sep 14, 2008
    Messages:
    128
    Likes Received:
    15
    i like affiliatexy.com aka AXY.com :D
     
    • Thanks Thanks x 1
  15. moonbitee

    moonbitee Junior Member

    Joined:
    Mar 26, 2009
    Messages:
    138
    Likes Received:
    63
    Location:
    SERPS
    affcentralops.com
     
    • Thanks Thanks x 1
  16. Echnaton

    Echnaton Newbie

    Joined:
    Feb 8, 2009
    Messages:
    8
    Likes Received:
    1
    Location:
    Vienna
    Fraux sounds like Fraud ;-)

    affible
    affimbo
    affizzle
    affibuddy
    affamigo

    all of course available als .com ;)

    ciao

    Echnaton
     
    • Thanks Thanks x 1
  17. Viltedali

    Viltedali Regular Member

    Joined:
    Feb 10, 2008
    Messages:
    305
    Likes Received:
    32
    Location:
    Midwest-US
    If goingwith the 'aff' theme like Echnaton, maybe:

    AFFOPIA
    AFFOFFICE
    AFFONE
    AFFEON
    AFFILT
    AFFIRL
    AFFUDE
     
    • Thanks Thanks x 1
  18. Rushdie

    Rushdie BANNED BANNED

    Joined:
    Feb 2, 2009
    Messages:
    1,378
    Likes Received:
    1,720
    thank you guys, you really helped us, im not 100% sure, but ill get you posted :)

    affiliateworld< this one was taken.
     
  19. buttercup

    buttercup Junior Member

    Joined:
    Sep 28, 2008
    Messages:
    174
    Likes Received:
    66
    Location:
    United States
    affiliatefaceoff <-for ranking features

    affiliatemeet <--for 2.0/social aspect

    Variations of these (and I don't know if they are taken, but you'd probably want to use them as a base of thought anyway)
     
    • Thanks Thanks x 1
  20. darkman

    darkman Regular Member

    Joined:
    Jan 17, 2009
    Messages:
    454
    Likes Received:
    264
    Better use part of a keyword in your domain.
    How abt. affiliateuniverse.com
     
    • Thanks Thanks x 1