1. This site uses cookies. By continuing to use this site, you are agreeing to our use of cookies. Learn More.

Available Domains - You may see something you like....or not

Discussion in 'Domain Names & Parking' started by Hawkster, Jul 24, 2015.

  1. Hawkster

    Hawkster Jr. VIP Jr. VIP

    Joined:
    Jun 22, 2013
    Messages:
    3,430
    Likes Received:
    3,621
    Gender:
    Male
    Occupation:
    Listen to everyone - Follow no-one
    Location:
    UK
    Home Page:
    Been messing around with scrapebox - Domain Look-Up Tool.

    Thought i would dump some currently available domains here. There is nothing special about these domains, although you may get lucky and find a good expired domain.

    Some of these are long and probably useless but im dumping them here anyway since i spent the time scraping them.



    Mobile app related

    Code:
    freemobileappsforiphone.com
    boostmobileapps.com
    freemobileappsdownloadsforsamsung.com
    cellularphonesamsungmobileapps.com
    boostmobileappsforlg.com
    boostmobileappsstore.com
    boostmobileappsforinnuendo.com
    downloadfreeboostmobileapps.com
    quickbooksmobileapps.com
    googlemobileappsblackberry.com
    freesamsungmobileappsgt-s5260themes.com
    bestmobileappsdownloads.com
    boostmobileappssamsung.com
    mobileappsforbusinessusers.com
    samsungmobileappsbootcamp.com
    bestsamsungmobileapps.com
    googlemobileappsdroid.com
    googlemobileappsdownload.com
    boostmobileappsforblackberry.com
    freemobileappsforbusiness.com
    match.commobileappsforandroid.com
    quickbooksmobileappsforexistingcustomers.com
    mobileappsforbusinessuk.com
    createmobileappforsmallbusiness.com
    yahoomobileappsforandroid.com
    googlemobileappsforbusiness.com
    freemobileappsforsamsung.com
    bestmobileappsdeveloperlanguage.com
    mobileappforevents.com
    mobileappsforbusinessproductivity.com
    googlemobileappsiphone.com
    freemobileappsforat&t.com
    freemobileappsgames.com
    freemobileappsforandroid.com
    advantagesofmobileappsforbusiness.com
    developingmobileappsforandroid.com
    mobileappsforbusinessmarketing.com
    quickbookspromobileapps.com
    freemobileappforsmallbusiness.com
    boostmobilemusicapps.com
    samsungmobileappsstorefree.com
    blackberryboostmobileapps.com
    benefitsofmobileappsforbusiness.com
    bestmobileappsforiphone.com
    windowsmobileappsforandroid.com
    windowsmobileappssmartphone.com
    freemobileappsforadministrativeprofessionals.com
    samsungmobileappsdownloadfree.com
    mobileappsforbusinesscards.com
    mostpopularmobileappsforandroid.com
    freemobileappsdownloads.com
    windowsmobileappsfreedownloads.com
    googleappsgooglemobileapps.com
    mobileappsforbusinessstatistics.com
    samsungmobileappsacademy.com
    bestmobileapps2015.com
    mobileappsforbusinessowners.com
    boostmobileappsforlgrumorreflex.com
    googlemobileappsanalytics.com
    googleboostmobileapps.com
    freesamsungmobileapps.com
    bestmobileappstosellitems.com
    boostmobileappsi465.com
    t-mobileappsforandroid.com
    bestmobileappsforsmallbusinesses.com
    topmobileappsforbusiness.com
    samsungmobileappslist.com
    freeboostmobileapps.com
    samsungmobileappsgames.com
    bestmobileappsforsmallbusinessowners.com
    bestboostmobileapps.com
    samsungmobileappsfort528g.com
    bestmobileappsforandroid.com
    redcrossorgmobileappsforandroid.com
    howtocreatemobileappsforandroid.com
    bestmobileappsforrestaurants.com
    yahoomobileapps.com
    boostmobileappsdownload.com
    googlemobileappsgmail.com
    chasemobileappsforandroid.com
    mobileappsforbusinessintelligence.com
    boostmobileappsforsamsungseek.com
    mobileappsforbusinesscommunication.com
    googlemobileappsforandroid.com
    planboostmobileappsboostmarketshop.com
    howtocreateamobileappforbusiness.com
    samsungmobileappsstore.com
    createfreemobileapps.com
    myboostmobileapps.com
    musthavewindowsmobileapps.com
    top10bestmobileapps.com
    microsoftwindowsmobileapps.com
    samsungmobileappsupdate.com
    appsmobileappsforsmallbusiness.com
    windowsmobileappsdownload.com
    googlemobileappswindowsmobile.com
    boostmobileappsforandroid.com
    samsungmobileappsgamesfreedownload.com
    quickbooksmobileappsdownload.com
    samsungmobileappsstoredownload.com
    downloadsamsungmobileapps.com
    freegooglemobileapps.com
    boostmobileappsforincognito.com
    samsungmobileappsfree.com
    windowsmobileappsstore.com
    topwindowsmobileapps.com
    samsungmobileappsapk.com
    Funny image related

    Code:
    reallyfunnypicturestumblr.com
    walmartshoppersfunnypicturesbystate.com
    funnyimagesofdogsinjail.com
    cupcakefunnyimageswithcaptions.com
    fridayfunnyimagesandquotes.com
    funnypicturesaboutlifetumblr.com
    funnyimagesofpeoplefallingdown.com
    strangewalmartshoppersfunnypictures.com
    weirdwalmartshoppersfunnypictures.com
    funnypicturesofpeopleatwork.com
    happybirthdayfunnypicturesjokes.com
    funnypicturesofdogssmiling.com
    funnyimagesofdogsinsemitrucks.com
    funnypicturesforkidstolookat.com
    sarcasticfunnypicturestumblr.com
    funnyimagesquotesaboutsex.com
    funnyimagesquotesofcaptainkirk.com
    funnypicturesofcatsincostumes.com
    happybirthdayfunnyimagesforfriend.com
    funnyimagesofpeopleeating.com
    mosharrafkarimfunnyimageswithcaptions.com
    funnyimageswithcaptionsaboutfriendship.com
    goodmorningfunnyimagesandquotes.com
    funnypicturesofdogsunderwater.com
    happyfridayfunnyimages&quotes.com
    funnyimagestumblr.com
    weekendfunnyimagesquotes.com
    funnyimagesofpeopleinlove.com
    freefunnypicturesfacebook.com
    cleanfunnypictureswithcaptions.com
    funnypicturequotesaboutsex.com
    funnypicturesofuglypeopleextremefunnypictures.com
    calumhoodfunnyphotostumblr.com
    funnyimagesofdogssleeping.com
    funnypictureswithcaptionsofanimals.com
    goodmorningfunnypictureswithcaptions.com
    funnypicturesfacebookstatus.com
    funnypicturesofpeopleofwalmart.com
    goodmorningfunnypicturestumblr.com
    freefunnyimagesforfacebook.com
    funnyimagesofanimalssayinghappybirthday.com
    funnyimagesforchildren.com
    funnyimagesongooglemapsstreetview.com
    merrychristmasfunnyimagesofpeople.com
    funnypictureswithcaptionstumblr.com
    funnypicturesofuglypeoplesuperuglypeople.com
    funnyimagesofpeoplegettinghurt.com
    happybirthdayfunnypictures.com
    funnypicturesforkidschildren.com
    99creepiestwalmartshoppersfunnypictures2014.com
    reallyfunnypicturesofcats.com
    cuteandfunnypicturesofanimals.com
    indiangoodmorningfunnypictures.com
    withoutgirlfriendfunnyimageswithcaptions.com
    reallyfunnypicturesofdogs.com
    mondayfunnyimagesandquotes.com
    funnypictureswithcaptionsforfriends.com
    funnypicturesaboutlifecoaching.com
    superfunnyimageswithcaptions.com
    happybirthdayfunnypicturestumblr.com
    thanksgivingfunnyimagesandquotes.com
    extremefunnypictureswithwords.com
    funnypicturesofanimalsforkids.com
    happyeasterfunnyimagesforkids.com
    funnypicturesofdogssleeping.com
    funnypicturesofcatsandkittens.com
    funniestwalmartshoppersfunnypictures2014.com
    funnypicturestumblrgif.com
    funnypicturesofdogsandpuppies.com
    bestfunnyimagesforfacebook.com
    funnypicturesofdogswithcaptions.com
    funnyimagesofanimalstalking.com
    funnypicturesofuglypeopleatwalmart.com
    happybirthdayfunnyimagesandquotes.com
    mindblowingfunnypicturestumblr.com
    kevinhartfunnypicturequotes.com
    happybirthdayfunnypicturesforwomen.com
    freefunnyimagesofdogs.com
    freefunnypictureswithcaptions.com
    funnyimagesofpeople.com
    tuesdayfunnyphotosforkids.com
    thinkingofyoufunnypicturestumblr.com
    funnyphotoswithcaptionstoshareonfacebook.com
    funnypicturesofanimalswithsayings.com
    happybirthdayfunnypictureskids.com
    funnypicturestumblronedirection.com
    veryfunnyimages.com
    funnypicturesongooglemaps.com
    walmartshoppersfunnypicturesaretheyreal.com
    funnypicturequotesforfacebook.com
    funnypicturequotesandsayings.com
    bustingoutofjailfunnyimageoftheday.com
    funnyimagesforfacebookstatus.com
    happybirthdayfunnypicturescartoons.com
    happy50thbirthdayfunnyimagesforwomen.com
    funnyimageswithcaptions.com
    latestwalmartshoppersfunnypictures.com
    happybirthdayfunnyimagesformen.com
    freefunnypicturesofcatsanddogs.com
    happybirthdayfunnyimagesforwomen.com
    weirdfunnyphotostumblr.com
    freefunnypicturesforkids.com
    ravensymonefunnypicturequotes.com
    funnypicturesforkidshumor.com
    funnyimagesofpeopleatwalmart.com
    funnyimagesofanimalswithcaptions.com
    funnypicturesofcatsanddogs.com
    imggafunnyimagesquotescategory.com
    funnyimagesforfacebookwithcaptions.com
    funnypicturesofpeoplefalling.com
    funnyimagesofdogseating.com
    funnypictureswithquotes.com
    superfunnypicturestumblr.com
    walmartshoppersfunnypictures.com
    pinterestfunnypictureswithcaptions.com
    funnyimagesfacebook.com
    funnyphotosongooglemaps.com
    funnypicturesofcatswithguns.com
    funnypicturesofuglypeople.com
    happybirthdayfunnypicturesandsayings.com
    goodgoodmorningfunnyimages.com
    funnyimagesongooglemaps.com
    funnypicturesofuglypeoplefunnyanimals.com
    funnypicturesforkidstoprintout.com
    superextremefunnypictureswithcaptions.com
    funnyimagesfacebookpacquiaovsmayweather.com
    funnypicturesofuglypeoplestupidwomen.com
    funnypicturesofpeopleeating.com
    funnypicturesofcatsandbabies.com
    freehappybirthdayfunnyimages.com
    funnyimagesofpeopledrinkingcoffee.com
    freehappybirthdayfunnypictures.com
    funnypictureofthedayoffnowork.com
    extremefunnypicturesforadults.com
    funnyimagesaboutlife'slessions.com
    funnyimagesofpeoplecrying.com
    sisterandbrotherfunnyimagesforfacebook.com
    funnypicturesofpeoplewithcaptions.com
    funnyphotostumblr.com
    funnyphotosfacebookfail.com
    ridiculousfunnyimageswithcaptions.com
    funnyimagesforfacebookcomments.com
    onedirectionfunnypicturestumblr.com
    reallyfunnypicturesofuglypeople.com
    funnypicturesofdogsdressedup.com
    funnypictureofthedaythread.com
    goodmorningfunnyimagesofbabies.com
    goodmorningfunnyimages.com
    superfunnypicturesofanimals.com
    godisincontrolfunnyimagesandquotes.com
    topfunnypicturesoftheday.com
    funnypicturesofanimalssleeping.com
    funnypicturesofcatsanddogstogether.com
    funnyimagesofdogsgraduating.com
    extremefunnypictureswithcaptions.com
    worstdressedwalmartshoppersfunnypictures.com
    funnypicturesofuglypeoplejokes.com
    happybirthdayfunnypicturesforfacebook.com
    funnyimagesofdogs.com
    funnypicturestumblrquotes.com
    cutefunnyimagesquotes.com
    funnyhappybirthdayfunnypictures.com
    funnypicturestumblrecards.com
    happybirthdayfunnypicturesfacebook.com
    superfunnyphotosforkids.com
    funnypicturesforkidswritingprompts.com
    funnypicturesofcatsdrivingcars.com
    walmartshoppersfunnypictures2014.com
    extremefunnypictureshumor.com
    extremefunnypicturesthewebsite.com
    funnypicturesofdogsandcats.com
    funnyimagesandquotesaboutsex.com
    crazyfunnypictureoftheday.com
    funnypicturesfacebook.com
    happybirthdayfunnyimagesfacebook.com
    funnypicturesforkidswithcaptions.com
    funnypicturesofuglypeopleandfat.com
    goodmorningfunnyimagesforfacebook.com
    funnypicturesofpeoplelaughing.com
    happybirthdayfunnyimagesgirls.com
    funnyimagesofdogsweekendwishes.com
    funnyimagesandquotesforfacebook.com
    funnypicturesaboutlife.com
    funnypicturesofdogsincostumes.com
    funnypicturesofcatswithwords.com
    happybirthdayfunnyimages.com
    happybirthdayfunnypicturesandquotes.com
    funnyimageswithcaptionsforco-workers.com
    funnypicturesofpeopleandanimals.com
    happy20thbirthdayfunnyimagesforwomen.com
    funnyimagesaboutlife.com
    funnyimagesofdogsincarswithcaptions.com
    goodmorningfunnypictures.com
    myspacehappybirthdayfunnyimages.com
    funnypicturesofpeoplesleeping.com
    happybirthdayfunnyimagesforfacebook.com
    funnypicturesofcatsholdingguns.com
    crazyfunnyphotosforkids.com
    funnyimagesandquotesaboutsarcasm.com
    photosofwalmartshoppersfunnypictures.com
    funnypicturesofcatssleeping.com
    happybirthdayfunnypicturesdogs.com
    celebrityfunnyimagesquotes.com
    funnypicturesofcatsfighting.com
    funnyphotoswithcaptions.com
    funnyphotosfacebookblogspot.com
    extremefunnypictureshumorgirls.com
    funnyimagesquotes.com
    funnypicturestumblrwithcaptions.com
    funnypicturesofuglypeoplewithcaptions.com
    starwarsfunnypicturesforkids.com
    funnyimagestumblrquotes.com
    freefunnypictureoftheday.com
    reallyfunnypicturesofanimals.com
    veryfunnyimagesofanimals.com
    funnyimagesforfacebookfriendstodiscuss.com
    happybirthdayfunnypicturesdownload.com
    funnypicturesofcatswithcaptions.com
    funnyimagesofanimalsandpeople.com
    funnyimagesandquotesaboutlife.com
    funnypicturequotesaboutrelationships.com
    extremefunnypicturesofdrunks.com
    extremefunnypicturesandjokes.com
    tgiffunnypicturequotes.com
    funnypicturequotesaboutlife.com
    funnypicturesongooglemapsstreetview.com
    funnypicturesofanimalssmiling.com
    superfunnypicturesforkids.com
    goodnightfunnyimagesofanimals.com
    veryfunnypictureswithcaptions.com
    funnypicturestumblrblog.com
    walmartiansfunnypicturesofuglypeople.com
    funnypictureofthedaytext.com
    funnypicturesofuglypeoplefunnypicturesofanimals.com
    goodmorningfunnypicturesfamily.com
    funnyimagesforfacebookprofile.com
    instagramfunnypicturequotes.com
    bestfunnyphotosfacebook.com
    onedirectionfunnyimageswithcaptions.com
    funnyimagesforkids.com
    funnyimagesofanimals2015.com
    sciencefunnyimagesforkids.com
    funnyimagesofanimals.com
    tgiffunnyimagesandquotes.com
    funnypicturesofdogsgoingtothevet.com
    funnypicturesofcatssayingthings.com
    funnyimagesofpeoplelaughing.com
    funnyimagesofanimalsworkingout.com
    harrypotterfunnypicturestumblr.com
    happy54thbirthdayfunnyimagesforwomen.com
    freefunnypicturesofanimals.com
    funnyphotosofdogs.com
    happybirthdayfunnypicturesformen.com
    googlemapsfunnyimages.com
    funnypicturesfacebookpages.com
    funnyimagesquotesfrom1980.com
    cleanfunnypicturesforkids.com
    mexicanfunnyimageoftheday.com
    goodmorningfunnypicturesandimages.com
    funnyimagesofanimalsfighting.com
    funnypicturesofpeopledancing.com
    funnypictureofthedayarchive.com
    funnypicturestumblr2013.com
    funnypicturestumblr2012.com
    funnypicturestumblruk.com
    funnyimagesofpeoplesleeping.com
    happybirthdayfunnyimagesforkids.com
    funnyphotosaboutlife.com
    goodmorningfunnypicturequotes.com
    funnypictureofthedayhumor.com
    happybirthdayfunnyimagesher.com
    onedirectionfunnypictureswithcaptions.com
    happybirthdayfunnypicturesfreedownload.com
    funnypicturesofanimalswithcaptions.com
    funnyimagesofanimalsatthebeach.com
    happybirthdayfunnypicturesmyspace.com
    happybirthdayfunnypicturesfree.com
    happybirthdayfunnyimagesforwomenecards.com
    reallyfunnypicturesforkids.com
    bestfunnypictureoftheday.com
    funnypicturesofpeoplerunning.com
    funnyimagesquotesaboutlife.com
    spanishfunnyimagesquotes.com
    vacationfunnyimagesfacebook.com
    funnypictureswithcaptionsforfacebook.com
    funnyimagesofdogsandcats.com
    happybirthdayfunnyimagesfromghetto.com
    cartoonsandfunnyimagestumblr.com
    
    Viral video related

    Code:
    outrageousviralvideos.com
    topviralvideostodayshow.com
    top10viralvideostoday.com
    timemagazinetoptenviralvideos2013.com
    whyareviralvideosfunny.com
    viralviralviralvideos.com
    topviralvideosapril2015.com
    bestfunnyviralvideos.com
    youtubeviralvideosforkids.com
    adidasstarviralvideos2014.com
    funnyviralvideosyoutube.com
    top100viralvideos2015.com
    toptenviralvideossites.com
    trynottolaughkidsreacttoviralvideos.com
    bestviralvideosfunny.com
    bestyoutubeviralvideos.com
    trackingviralvideosyoutube.com
    mostviralvideostoday.com
    funnyviralvideoslist.com
    toptenviralvideos2012.com
    toptenviralvideos2014.com
    toptenviralvideos2015.com
    youtubeviralvideosfunny.com
    youtubekidsreacttoviralvideos.com
    mostviralvideosoftheweek.com
    mostviralvideosonyoutube.com
    funniestviralvideos2014.com
    funniestviralvideos2015.com
    mostviralvideoslist.com
    outrageousviralvideosvideoclips.com
    topfunnyviralvideos2015.com
    top10youtubeviralvideos.com
    craziestviralvideosoftheweek.com
    viralvideosapponipad.com
    viralvideosyoutuberecitalrespect.com
    top5viralvideos2015.com
    mostviralvideosonfacebook.com
    yahootopviralvideos2015.com
    ghanaleaksviralvideos2014.com
    topviralvideos2015.com
    topviralvideos2014.com
    toptenviralvideosofalltime.com
    mostviralvideosthisweek.com
    viralvideosonfacebook.com
    topviralvideos2015yahoo.com
    kidsreacttoviralvideosyoutube.com
    mojotoptenviralvideos.com
    2014viralvideosyoutube.com
    viralvideosrightnow.com
    viralvideosoftheweekthinkingoutloud.com
    top20viralvideos2015.com
    funnyviralvideosoftheweek.com
    mostviralvideosever.com
    toptenviralvideosonyoutube.com
    top50viralvideos2015.com
    yahooviralvideosoftheweek.com
    top10viralvideos2015.com
    kidsreacttoviralvideossoccer.com
    youtubeviralvideostoday.com
    toptenviralvideosoftheweek.com
    freefunnyviralvideos.com
    youtubeviralvideosoftheweek.com
    toptenviralvideosyoutube.com
    kidsreacttoviralvideosducksong.com
    topyoutubeviralvideos.com
    kobebryantviralvideosyoutube.com
    viralvideosapril2015.com
    2014mostviralvideos.com
    roarviralviralvideos.com
    mostviralvideos2015.com
    mostviralvideos2013.com
    murfreesboro.comviralvideosyoutube.com
    originalyoutubeviralvideos.com
    top10mostviralvideos.com
    viralvideostodayshow.com
    youtubebestbestbestviralvideos2014.com
    youtubeviralvideosyoutubeviralfever.com
    timemagazinetoptenviralvideos.com
    foxnewsviralvideosoftheweek.com
    topviralvideos2015youtube.com
    mostviralvideosintheworld.com
    kidsreacttoviralvideosnyancat.com
    funnyviralvideosstupidvideos.com
    saltnpepaviralviralvideos.com
    sxswviralvideosoftheweek.com
    mostviralvideosofalltime.com
    toptenviralvideosfunny.com
    toptenviralvideosoutrageousviralvideos.com
    kidsreacttoviralvideoslia.com
    kidsreacttoviralvideossmosh.com
    totallyoutrageousviralvideos.com
    outrageousviralvideosepisode2.com
    10yearsofyoutubeviralvideos.com
    newfunnyviralvideos.com
    topfunnyviralvideos.com
    topviralvideostoday.com
    pinoyfunnyviralvideos.com
    mostviralvideosalltime.com
    10mostviralvideos.com
    youtubeviralvideos2014.com
    youtubeviralvideos2015.com
    toptenviralvideosfromtheancientinternet.com
    mostviralvideosinindia.com
    kidsreacttoviralvideosgangnamstyle.com
    funnyviralvideos2014.com
    funnyviralvideos2015.com
    viralvideos2014.com
    viralvideos2015.com
    youtubeviralvideosapp.com
    kidsreacttoviralvideossittinonthatoilet.com
    mostviralvideosyoutube.com
    toptenviralvideosever.com
    bestviralvideosfunny2015.com
    kidsreacttoviralvideosgoingtothestore.com
    trendingviralvideosonfacebook.com
    viralviralvideosfourthofjuly.com
    kidsreacttoviralvideos.com
    bestviralvideosonfacebook.com
    bestviralvideos2014.com
    bestviralvideos2015.com
    viralvideosapp.com
    funnyviralvideosfunnyvideoclips.com
    mostoutrageousviralvideos.com
    outrageousviralvideosyoutube.com
    2009viralvideosfunny.com
    viralvideosfunnyvideos.com
    topviralvideosoftheweek.com
    viralvideosfunnyplace.com
    toptenviralvideosthisweek.com
    toptenviralvideosof2011.com
    bestviralvideosoftheweek.com
    
    affiliate related

    Code:
    affiliatedfoodsmidwestelwoodks.com
    amazonaffiliateid.com
    affiliateddistributorsplanotx.com
    affiliateprogramsthatpayinstantly.com
    affiliatedfoodsmidwestfoodshow.com
    adproposalformaffiliatedfoodsmidwest.com
    amazonaffiliateprogramsignup.com
    listofbestaffiliateprogramscommissions.com
    affiliateddermatologyanthemaz.com
    affiliatedfoodskenosha.com
    affiliatedfoodsinc.com
    affiliatesummiteastparties.com
    wealthyaffiliatevsaffilorama.com
    affiliatedmanagersgroupheadquarters.com
    surgicalcareaffiliateslocations.com
    affiliateddermatologylibertycornernj.com
    affiliateddistributorsrewardslogin.com
    bestaffiliateprogramsforbloggers.com
    surgicalcareaffiliatessacramento.com
    surgicalcareaffiliatesllc.com
    bestaffiliateprogramscommissions.com
    affiliatedmanagersgrouplogo.com
    affiliatesummiteast2013philadelphia.com
    affiliateddermatologydublinohio.com
    affiliatedfoodsmidwestjobs.com
    wealthyaffiliatecost.com
    affiliateddistributorsnorthamerica.com
    affiliateddefinitiondictionary.com
    affiliatesummiteastmeetmarket.com
    affiliatedengineerssanfrancisco.com
    affiliateddistributorsinc.com
    affiliateddistributorsa-d.com
    affiliatedfoodsmidweststores.com
    amazonaffiliateprogramillinois.com
    scasurgicalcareaffiliates.com
    affiliatedfoodsmidwestgrocerystore.com
    amazonaffiliateprogramamazonassociatesprogram.com
    affiliatedengineerschapelhillnc.com
    affiliateprogramsthatdon'trequireawebsite.com
    wealthyaffiliatemoneymakingprogram.com
    affiliatedfoodselwoodks.com
    affiliatedmanagersgroupbostonaddress.com
    affiliatedmanagersgroupstock.com
    affiliatedengineersmadisonwi.com
    affiliatesummiteast2015.com
    affiliatesummiteast2016.com
    surgicalcareaffiliatesstockprice.com
    affiliatesummiteastconference.com
    surgicalcareaffiliatescorporateaddress.com
    affiliateddistributorsbuyinggroup.com
    affiliateprogramsforblogs.com
    amazonaffiliateprogramphonenumber.com
    wealthyaffiliatesuccessstories.com
    nonaffiliateddefinition.com
    notaffiliateddefinition.com
    adaffiliateddistributors.com
    affiliateprogramsforbeautybloggers.com
    affiliateddermatologyscottsdale.com
    affiliatedengineersseattle.com
    affiliatedfoodsamarillotxapplication.com
    aeiaffiliatedengineers.com
    surgicalcareaffiliatesgreensboronc.com
    bestaffiliateprogramsforbeginners.com
    affiliateddistributorsmembers.com
    affiliatedengineershouston.com
    wealthyaffiliateuniversityscam.com
    affiliatedfoodsamarillo.com
    affiliateddistributorsmemberslist.com
    amazonaffiliatelink.com
    affiliatedengineersphoenix.com
    affiliatesummiteast.com
    amazonaffiliateprogramreview.com
    affiliateddefinitions.com
    affiliateddermatologyrichmondva.com
    howdoesamazonaffiliateprogramwork.com
    affiliatedfoodsmidwestnorfolkne.com
    affiliatedfoodssouthwest.com
    affiliatedmortgagecompany.com
    affiliateddermatologyaz.com
    affiliateddermatologynj.com
    surgicalcareaffiliatescareers.com
    affiliateddermatologybrookfieldwi.com
    affiliatesummiteastagenda.com
    bestaffiliateprogramswithfreewebsites.com
    affiliatedmanagersgroupinvestorrelations.com
    affiliateprogramsamazon.com
    affiliatedmanagersgroupinc.com
    affiliatedfoodselwoodkansas.com
    affiliatedfoodsjobs.com
    affiliateprogramsforfoodbloggers.com
    affiliateddefinition.com
    amgaffiliatedmanagersgroup.com
    affiliatedfoodsmidwestnorfolknebraska.com
    surgicalcareaffiliatesbirmingham.com
    affiliateddermatologyphoenixaz.com
    bestaffiliateprogramstojoin.com
    wealthyaffiliatewiki.com
    affiliatedmanagersgroupreviews.com
    affiliatedfoodsmidwestkenosha.com
    affiliatedmanagersgroupconshohocken.com
    surgicalcareaffiliatesheadquarters.com
    affiliatedfoodsmidwestspringfoodshow2015.com
    affiliatedengineersgainesville.com
    affiliatedfoodslittlerockar.com
    amazonaffiliateprogramscam.com
    affiliateddermatologymorristownnj.com
    affiliatedengineersinc.com
    andy'saffiliatedfoodssiouxfallssd.com
    amazonaffiliateprogramcommission.com
    amazonaffiliateprogramsuccessstories.com
    wealthyaffiliatesalary.com
    amazonaffiliateprogramlogin.com
    affiliatedfoodsmidwestadform.com
    billweisbergaffiliateddistributors.com
    affiliatesummiteastdiscountcode.com
    affiliatedengineerschicago.com
    affiliatedfoodsnebraska.com
    affiliatedmanagersgroupjobs.com
    affiliatesummiteast2014meetmarket.com
    wealthyaffiliateuniversityreviews.com
    gangaffiliateddefinition.com
    affiliatesummiteast2013dates.com
    
    Healthy recipe related

    Code:
    healthyrecipesforpickyeaters.com
    healthyrecipeswithgroundbeef.com
    healthyrecipeswithgroundturkey.com
    healthyrecipespinterest.com
    healthyrecipeswithchicken.com
    healthyrecipesonabudget.com
    freehearthealthyrecipes.com
    healthyrecipeswithchickencutlets.com
    freecheaphealthyrecipes.com
    healthyrecipeswithchickentenders.com
    cheaphealthyrecipesfortwo.com
    funhealthyrecipesforpickyeaters.com
    besthealthyrecipespinterest.com
    healthyrecipesforpickyeaters.com
    greathealthyrecipeswithgroundbeef.com
    healthyrecipeswithgroundbeeffordinner.com
    goodhealthyrecipeswithgroundbeef.com
    healthyrecipeswithgroundbeef.com
    hearthealthyrecipesforpickyeaters.com
    healthyrecipeswithchickenthighs.com
    hearthealthyrecipeswithgroundbeef.com
    healthyrecipesforkidslunches.com
    superhealthyrecipesforweightloss.com
    healthyrecipeswithgroundturkeybreast.com
    quickhealthyrecipeswithgroundturkey.com
    healthyrecipeswithgroundbeefandbroccoli.com
    summerhealthyrecipespinterest.com
    quick&healthyrecipesandideas.com
    simplecheaphealthyrecipes.com
    healthyrecipesonabudgetblog.com
    simplehearthealthyrecipes.com
    healthyrecipeswithgroundbeefunder300calories.com
    healthyrecipeswithgroundbeefmeat.com
    healthyrecipeswithgroundbeefandpasta.com
    freehealthyrecipesonabudget.com
    healthyrecipesforkidstomake.com
    bisquickhearthealthyrecipes.com
    healthyrecipesfortwopeople.com
    hearthealthyrecipesonabudget.com
    easyhealthyrecipewithgroundturkey.com
    healthyvegetarianrecipesforpickyeaters.com
    quickhealthyrecipeswithgroundbeef.com
    quickandeasyhealthyrecipesfordinner.com
    quickhealthyrecipesfordinner.com
    quick&easyhealthyrecipesfortwo.com
    simplehealthyrecipeswithchicken.com
    healthyrecipesforpickyeatersadults.com
    easyhealthyrecipespinterest.com
    quickhealthyrecipesforpickyeaters.com
    healthyrecipesforkidsmeals.com
    quickhealthyrecipesonabudget.com
    healthyrecipeswithgroundturkey.com
    delicioushealthyrecipesfordinner.com
    trimhealthyrecipespinterest.com
    simplehealthyrecipesforseniors.com
    healthyrecipesonabudgetforweightloss.com
    healthyrecipesforweightlossandmusclegain.com
    healthyrecipeswithgroundbeefandblackbeans.com
    easyhealthyrecipeswithgroundturkey.com
    funhealthyrecipesforkids.com
    hearthealthyrecipespinterest.com
    kidfriendlyhealthyrecipesonabudget.com
    simplequickhealthyrecipes.com
    delicioushealthyrecipespinterest.com
    healthyrecipeswithgroundbeefandpotatoes.com
    healthyrecipeswithgroundbeefincrockpot.com
    quickandhealthyrecipesforkids.com
    cheaphealthyrecipesfordinner.com
    simplehealthyrecipesforbreakfast.com
    easyhealthyrecipesforpickyeaters.com
    easyhealthyrecipeswithgroundbeef.com
    hearthealthyrecipesforkids.com
    simplehealthyrecipeschickenbreast.com
    diabeticandhearthealthyrecipes.com
    verysimplehealthyrecipes.com
    healthyrecipeswithgroundbeefandbrownrice.com
    healthyrecipespinterest.com
    quick&easyhealthyrecipes.com
    healthyrecipeswithgroundbeefandnoodles.com
    hearthealthyrecipesfortwo.com
    healthyrecipeswithchicken.com
    cheaphealthyrecipesmeals.com
    realsimplehealthyrecipes.com
    freehealthyrecipesforpickyeaters.com
    easyquickhealthyrecipes.com
    healthychickenrecipesforpickyeaters.com
    healthyrecipeswithgroundturkeyandbrownrice.com
    quick&easycheaphealthyrecipes.com
    healthyrecipeswithchickensausage.com
    easyhealthyrecipesfortwo.com
    healthyrecipesforpickyeaterskids.com
    easyhealthyrecipesforone.com
    healthyrecipesforpickyeatersdinner.com
    quickcheaphealthyrecipes.com
    fastcheaphealthyrecipes.com
    besthealthyrecipesfortwo.com
    easyhealthyrecipesonabudget.com
    healthyrecipeswithgroundturkeymeat.com
    lowsodiumhearthealthyrecipes.com
    healthyrecipesforpickyeatersblog.com
    easyhealthyrecipesforweightloss.com
    healthyrecipeswithchickenandmushrooms.com
    healthyfoodsforpickyeatersadults.com
    favedietsquick&healthyrecipes.com
    healthyrecipeswithchickenbreast.com
    healthyfamilyrecipesforpickyeaters.com
    easyhealthyrecipesforcollegestudents.com
    hearthealthyrecipesamericanheartassociation.com
    hearthealthyrecipeswithgroundturkey.com
    greathealthyrecipesfordinner.com
    eatinghealthyrecipesfortwo.com
    healthyrecipeswithgroundturkeyandcorn.com
    goodhealthyrecipesfordinner.com
    kidshealthyrecipespinterest.com
    healthyrecipesfordinneronabudget.com
    quickhearthealthyrecipes.com
    healthyrecipesforweightlossin30minutesorless.com
    fasteasyhealthyrecipes.com
    mayoclinichearthealthyrecipes.com
    eathealthyrecipesonabudget.com
    quickhealthyrecipesforweightloss.com
    healthyrecipesforkidsdinner.com
    hearthealthyrecipeslow-fat.com
    healthyrecipesfordinnerfortwo.com
    healthyrecipeswithgroundturkeyandpotatoes.com
    bestquickhealthyrecipes.com
    simplehealthyrecipesforkids.com
    besthealthyrecipesonabudget.com
    healthyrecipesforweightlossforkids.com
    healthyrecipesforpickyeaterstoddlers.com
    easyhealthyrecipeswithchicken.com
    quicksimplehealthyrecipes.com
    fasthealthyrecipesforpickyeaters.com
    besthealthyrecipeswithgroundbeef.com
    simplehealthyrecipesfortwo.com
    healthyrecipeswithchickenbroth.com
    freehealthyrecipesforweightloss.com
    healthyrecipeswithchickenandspinach.com
    diabetichealthyrecipesonabudget.com
    indianhealthyrecipesforkids.com
    toddlerhealthyrecipesforpickyeaters.com
    low-caloriehealthyrecipespinterest.com
    healthyrecipewithgroundturkey.com
    healthyrecipesforweightlossanti-inflammatorydiet.com
    easyhearthealthyrecipes.com
    healthyrecipesforweightlossonabudget.com
    easycheaphealthyrecipes.com
    quickhealthyrecipesforkids.com
    cheaphealthyrecipesforfamilies.com
    healthyrecipesforweightlossthattastegood.com
    healthyrecipesfortwoonabudget.com
    healthyrecipesonabudget.com
    simplehealthyrecipesforpickyeaters.com
    simplehealthyrecipeswithgroundbeef.com
    
    making money online related

    Code:
    makemoneyonlinefreehome.com
    makingmoneyonlinefromhomewithbarbara'sprogram.com
    makemoneyonlinewithgoogleimagelabeler.com
    canyoumakemoneyonlinesurveys.com
    makingmoneyonlinefromhomeuk.com
    makingmoneyonlinefromhomegoogle.com
    makingmoneyonlinewithgoogle.com
    makingmoneyonlinefromhomecanada.com
    makingmoneyonlinefromhomenofee.com
    canyoumakemoneyonlinewithgoogle.com
    makingmoneyonlineforfreewhatispaypal.com
    makemoneyonlinereddit.com
    howtostartmakemoneyonline.com
    howtostartmakingmoneyonlinewithnomoney.com
    makemoneyonlinebusinessopportunity.com
    howdoyoumakemoneyonlinewithgoogle.com
    makemoneyonlinewithoutadvertising.com
    howtomakemoneyonlinereddit.com
    makingmoneyusingonlineadvertising.com
    youtubemakingmoneyonline.com
    waysofmakingmoneyonlineforfree.com
    secretstomakingmoneyonlineforfree.com
    startmakingmoneyonlinefromhome.com
    makemoneyonlineadvertisingwebsite.com
    bestwaytomakemoneyonlinepoker.com
    canyoumakemoneyonlinepoker.com
    makemoneyonlinesurveyslegit.com
    realwaystomakemoneyonline2015.com
    makemoneyonlinepoker.com
    makemoneysellingadvertisingonline.com
    makemoneyonlineforumdiscussion.com
    makingmoneyonlinelegit.com
    waystomakemoneyonlinewithoutspendingmoney.com
    makemoneyonlinefastnofees.com
    makingmoneyonlinesurveys.com
    makemoneyonlinegooglesniper.com
    makingmoneyonlinewithoutspendingmoney.com
    howmakemoneyonlinepoker.com
    singlemommakingmoneyonlinefromhome.com
    makingmoneyonlineforfreeindia.com
    makingmoneyonlinepoker.com
    oprahwinfrey20-20makingmoneyonlinefast.com
    makingmoneyonlinescamspaidsurveys.com
    makemoneyonlinesurveyscanada.com
    waystomakemoneyonline2015.com
    makemoneyonlinesurveysscam.com
    makemoneyonlinepokerforum.com
    howtomakemoneyonlineadvertising.com
    makingmoneyonlinelegitcompanies.com
    makingmoneyonlinefreeandfast.com
    bestwaytomakemoneyonlineforum.com
    makemoneyonlineforum2012.com
    makingmoneyonlinewithgoogleforfree.com
    howtostartmakingmoneyonlinetoday.com
    makemoneyonlinewithgooglewithoutanyinvestment.com
    howtostartmakingmoneyonlineforfree.com
    makingmoneyonlinefreeandeasy.com
    makingmoneyonlinefromhome-malaysia.com
    makingmoneyonlinefromhome2012.com
    makingmoneyonlinefromhome2013.com
    makingmoneyonlinefromhome2015.com
    makemoneyonlinewithgoogleadsense.com
    makingmoneyonlinefreeregistration.com
    waystomakemoneyonlineforums.com
    makingmoneyonlinefastreviews.com
    makemoneyathomeonlineadvertising.com
    makingmoneyonlineforfreetoday.com
    makingmoneyonlineforums.com
    dopeoplemakemoneyonlinepoker.com
    makingmoneyonlinescamsrevealed.com
    makingmoneyonlinefreeofcharge.com
    howcanimakemoneyonlinewithoutspendingmoney.com
    opportunitymakingmoneyonlinefromhome.com
    startmakingmoneyonlinefree.com
    oddsofmakingmoneyonlinepoker.com
    makemoneyonlinewithoutspendingmoney.com
    topreviewsformakingmoneyonlineforfree.com
    makingmoneyonlinereddit.com
    isitpossibletomakemoneyonlinepoker.com
    cnnmakemoneyonlinewithgoogle.com
    howtomakemoneyonlineforums.com
    startmakingmoneyonlineforfree.com
    freewaystomakemoneyonlinefast.com
    listofmakemoneyonlinescams.com
    howdoesyoutubemakemoneyonline.com
    howtomakemoneyonlinescams.com
    makingmoneyonlinewithgoogleadsense.com
    makemoneyonlinewithgoogle2012.com
    makingmoneyonlinewithgooglepostinglinks.com
    bestsitetomakemoneyonlinepoker.com
    howtomakemoneyonlinewithgoogle.com
    youtubemakemoneyonlinefree.com
    makemoneyonlinewithgoogleebaybestbuyonyoutubevideo.com
    makemoneyonlineadvertisinggoogle.com
    makingmoneyonlinefreeofcost.com
    makingmoneyonlinefreenoscams.com
    kidsmakingmoneyonlineforfree.com
    listofmakingmoneyonlinescams.com
    makingmoneyonlinewithgoogleadwords.com
    howtomakemoneyonlineadvertisingforcompanies.com
    makemoneyonlineadvertisingforcompanies.com
    makingmoneyonlineforfreegoogle.com
    waystomakemoneyonlinewithgoogle.com
    makemoneyadvertisingonlinefree.com
    makemoneyonlinewithgoogleforfree.com
    makemoneyonlinesurveyspaypal.com
    waystomakemoneyonlinefree.com
    makemoneyonlinewithgoogleinindia.com
    waystomakemoneyonlinefast.com
    newwaystomakemoneyonline2015.com
    makingmoneyonlinefromhomeforfreetostart.com
    makingmoneyonlinefromhomeinnigeria.com
    makemoneyonlinesurveysnofees.com
    makingmoneyonlinelegitimately.com
    makemoneyonlineadvertisingcompanies.com
    makingmoneyonlinefastandfree.com
    makemoneyonlineblogadvertising.com
    makingmoneyonlinesurveysfree.com
    howdoyoumakemoneyonlinewithoutspendingmoney.com
    waystomakemoneyonlineforum.com
    makingmoneyonline-legitimately(nomoneydown).com
    howtomakemoneyonlinewithoutspendingmoney.com
    makingmoneyonlinebusinessopportunityinindia.com
    makingmoneyonlinefromhomenoscams.com
    youtubemakingmoneyonlinegenesispure.com
    makemoneyonlinesurveysreviews.com
    makingmoneyonlineforfreewithnocost.com
    makingmoneyonlinefromhomeforfree.com
    easiestwaytomakemoneyonlinepoker.com
    waystomakemoneyonlinesurveys.com
    
     
    • Thanks Thanks x 1
  2. aoe316

    aoe316 Regular Member

    Joined:
    Sep 25, 2013
    Messages:
    254
    Likes Received:
    100
    Thanks for the share. Do you have any advise on looking for expired domains with scrapebox?
     
  3. Hawkster

    Hawkster Jr. VIP Jr. VIP

    Joined:
    Jun 22, 2013
    Messages:
    3,430
    Likes Received:
    3,621
    Gender:
    Male
    Occupation:
    Listen to everyone - Follow no-one
    Location:
    UK
    Home Page:
    Im literally an hour into using scrapebox buddy so im not totally sure, i did have just a quick look on google about it earlier but didn't see anything.